PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g014170.1
Common NameMTR_2g014170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 310aa    MW: 33880.3 Da    PI: 8.9332
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g014170.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.56.2e-3841101262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg r+n++++
  Medtr2g014170.1  41 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGYRRNNSNK 101
                      7899****************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-324399IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-244494IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7984599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MLSNYEKMLV IPPTTNQWTQ NQIDDVKIME KQGQKLHQQQ QQQALKCPRC DSSNTKFCYY  60
NNYSLSQPRH FCKACKRYWT RGGTLRNVPV GGGYRRNNSN KRSNNTTLIK IPSTIDTSIS  120
SSPSTPSSTP NTTSSNSTLN HNISPMFYGL SSSNSCDVNL PFSRFNISRL STSSGYDFQP  180
QMNTIGLGFS SGFTSSEAND HNGYTNGFTS RYGSIFSSSS VPSNASVMPS LLQHKFINDG  240
SNSFQGLEFN NLGNGSEKGT KKDEGEMEHV GGLYDPAASS LYWNTASSSA IGVWNDQASN  300
IGSSVTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1468550.0AC146855.5 Medicago truncatula clone mth2-16c23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593614.10.0Dof-type zinc finger DNA-binding family protein
TrEMBLG7ISD20.0G7ISD2_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGVIT_10s0003g00040.t014e-79(Vitis vinifera)
STRINGGLYMA13G31100.11e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.23e-34Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]